PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_02559A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 333aa    MW: 36078.3 Da    PI: 7.927
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_02559AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.11e-181562148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd++l+ +++q+G g+W++ +++ g++R++k+c++rw +yl
  Oropetium_20150105_02559A 15 KGPWTPEEDQKLLAYIEQHGHGCWRSLPAKAGLRRCGKSCRLRWTNYL 62
                               79********************************************97 PP

2Myb_DNA-binding54.52.6e-1768113148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                rg++T +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Oropetium_20150105_02559A  68 RGKFTLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 113
                                89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-25765IPR009057Homeodomain-like
PROSITE profilePS5129418.6391062IPR017930Myb domain
SuperFamilySSF466892.27E-3012109IPR009057Homeodomain-like
SMARTSM007171.6E-151464IPR001005SANT/Myb domain
PfamPF002497.6E-171562IPR001005SANT/Myb domain
CDDcd001676.31E-121762No hitNo description
PROSITE profilePS5129426.33363117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2666117IPR009057Homeodomain-like
SMARTSM007175.8E-1767115IPR001005SANT/Myb domain
PfamPF002491.7E-1668113IPR001005SANT/Myb domain
CDDcd001677.79E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRSPCCEKE AGLKKGPWTP EEDQKLLAYI EQHGHGCWRS LPAKAGLRRC GKSCRLRWTN  60
YLRPDIKRGK FTLQEEQTII QLHALLGNRW SAIATHLPKR TDNEIKNYWN THLKKRLAKM  120
GIDPVTHKPR ADGPASSSSP AGASRYRAAA HLSHTAQWES ARLEAEARLA REAKLRALAS  180
PPPPPPPAAA AASGLESPTS TLSFSDQSAL FANAAAQPVH HQTPHSYVDA FGEPQHHRFD  240
EPATAAQQQA DGFLARVLLD CSVAGAEQGF AATSTTDPSA GDREEEEDKG YWNSILSMVN  300
SSMSSSSSSL TSEAVTDQQH AVYLPAAAVA EF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0853910.0BT085391.2 Zea mays full-length cDNA clone ZM_BFc0006G19 mRNA, complete cds.
GenBankBT0863810.0BT086381.2 Zea mays full-length cDNA clone ZM_BFc0159P01 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952890.11e-156PREDICTED: myb-related protein Zm38-like
TrEMBLA0A096PQ631e-164A0A096PQ63_MAIZE; Uncharacterized protein
STRINGGRMZM2G001223_P031e-163(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.14e-87myb domain protein 16